Directed by Chris Morgan ... [ Ссылка ]
Produced by Geoff Farr / GSF Agency ... [ Ссылка ]
While the New TVS Pro is a 'reissue' of the TVS with the classic SEM sound of the '70s, a few details have transformed this instrument. Once destined to sit atop a Hammond B-3 or in a multi-keyboard setup, the new TVS is at home in any modular system, providing handy pitch and timing reference, and shining as an excellent compact master keyboard for playing polyphonic synths without having to fire up the DAW.
In this video, the Tom Oberheim TVS Pro plays sequence #1, while supplying clock to the modular systems' sequencers. External sounds include a Karp hi hat; Wiard kick, Mayhem and Pedal tone; a Tonestar grand casa; MiniMod Bass; Elements chunk; Serge funk; Serge and Nebulae suspense and 2 Roland MKS 80 Super Jupiters pads, played from TVS Pro Keyboard with Local OFF.
The music in the video is performed live, without overdubbing or editing. Special thanks to Anthony Baldino for sprucing up the mix before the shoot.
-Gary Chang
Tom Oberheim Two Voice Pro Excerpt by Gary Chang
Теги
tvsoberheimtomoberheim.comspaceechoob6tvsprosemanaloggearfunksynthsdemoudoaudiosuper6synthesizerhybrid synthhybridsynthmusicproducersynthpornsynthnerdsynthkeyboardplayerudosuper6synthmusicstudiobeatheppyheppykatsynthwavesynthlifekeyboardtomoberheimOberheimtwovoicetwovoicepropolyphonicsynthpolysynthvintageproducerStudioLifefenderrhodesrhodesps1aphaseshiftermaestromaestrophaseshifter