Shop at MyProtein (Use Code "JOE" for 30% off your entire order)- [ Ссылка ]
My Workout Program - [ Ссылка ]
Instagram - joefazer
Snapchat- joefazerfitness
Business Enquiries - itsfazzler@gmail.com
Hi i'm Joe, I have created this YouTube channel to show my progression from a skinny teenager who is sick of being skinny to hopefully in the future being more muscular and just better in general both physically and mentally.
If you do enjoy my content it would mean lot if you could hit the like button and maybe even consider subscribing. Thank you!
Music:
Do Protein Shakes Cause Acne?
Теги
gymyoutubebodybuilderpowerliftervlogvloggingfunnymuscleeatingdavidlaiddavidlaidgymsharkprotein shakesacneacne breakouthow to deal with acnehow to stop acneprotein shakes acneare protein shakes bad for youbest ways to treat acnehow to stop acne breakoutsdo supplements cause acnewhey and acnedoes whey cause acneshould you stop drinking protein shakesdo protein shakes cause spotsdoes protein cause acneprotein shake giving me more spots
