Thanks so much for watching!
00:00 Preamble
00:55 Section 1: Foundations
01:27 Intro shots and setting the scene
02:40 Nostromo
03:25 The Perils of Masculine Exploration
05:44 Concerns over rapid scientific advancement
06:20 Problematic race depictions in Conrad’s work
06:42 The fear of encountering a dominant racial other
07:05 White unease over increasing racial equality
07:33 What is the name Nostromo signalling?
08:10 MUTHUR
08:48 Yeah, it’s meant to look like one of those.
09:32 H.R. Giger
09:59 Why is MUTHUR called MUTHUR?
10:22 The Perversion of Pregnancy
10:44 I.V.F. and the future of the natural process
14:20 Building a birthing scene
17:30 The sterile birth of the future
19:22 Equality and crew hierarchy
24:24 Concerns equal rights meant diminished power for white men
25:08 Critics suggest racism in the alien franchise
25:55 The news in 1978
27:04 Corporate Hierarchy and future bureaucracy
28:45 ‘The Company’
29:10 Summing up themes and anxieties
32:40 Section 2: LV-426
32:45 The Talented Mrs Ripley
33:06 Crew Meeting
33:40 Gender Inversion
34:49 Emphasized Sexuality of Alien Designs
36:16 Dulled sexuality of humans
38:00 Eggs, perversion and the foreign invader
42:17 Ripley defends the nest
45:20 Facehugger
47:10 Ripley Confronts Ash
50:04 A difference of opinion
51:06 Section 3: Xenomorph
51:20 The lack of calm before the storm
53:44 Chestburster and the feminization of Kane
58:05 Time to fight back
58:55 Brett
59:50 Adult Xeno and depictions of race
01:00:38 See on screen for ‘Eshu’ theory
01:02:02 Parker, Brett and the Xenomorph
01:04:05 Incorrect Penetration
01:06:19 Potential Mirroring, Potential Crazy Critics
01:08:38 Section 4: Ellen Ripley
01:08:44 Dallas consults capitalism (it says no)
01:09:11 Technology and the subversion of male heroism
01:10:23 Ripley in charge
01:11:09 Ripley vs Science
01:11:52 Ripley vs Ash
01:15:01 Ripley, in Red and White
01:19:40 Corrective Penetration feat. Jonathan Harker
01:22:48 Jonesy the Cat
01:24:01 Parker and Lambert
01:25:06 Ripley escapes
01:25:51 Feminist Criticism of Final Sequence
01:29:00 Why it’s awesome
01:30:45 Final Thoughts
01:32:42 Outro, Chaos Magnum & Gratitude
READ CHAOS MAGNUM HERE:
[ Ссылка ]
SUPPORT ME ON PATREON:
patreon.com/novum
More videos coming very soon, if you have anything in particular you wanna see let me know in the comments!
Cheers!
The Complete Companion Guide to Alien
Теги
alienaliensfranchisesigourney weaveryaphet kotokotodied1979ivfracismsexismequalitywhat does it meanoriginseaster egssxeno morphxenomorphfacehuggerchestburstereverything explainedcomplete guideripleyellen ripleysecretufospaceshiplv-426prometheusengineerhorrora24feministessayunbridledlongridley scottjames cameronblade runnermeaningspacewhyashkaneparkerlambertbrettjonesy the catacademichistorymichaeljohn hurtbilboholmcia