Part 1 of the Myth Bust Monday Season 1 Finale! Here are all the topics covered:
1. Are High Protein Diets Bad For Bone and Kidney Health?
[ Ссылка ]
2. Is There a Post-Workout “Anabolic Window”?
[ Ссылка ]
3. Is Sugar Making Us Fat?
Part 1- [ Ссылка ]
Part 2 - [ Ссылка ]
4. Does Weight Training Stunt Growth?
[ Ссылка ]
5. Can You Only Absorb 30g of Protein in One Meal?
[ Ссылка ]
6. Does Fasted Cardio Burn More Fat?
[ Ссылка ]
7. Do Carbs Before Bed Make You Fat?
[ Ссылка ]
8. Does Foam Rolling Work?
[ Ссылка ]
9. Are energy drinks bad for you?
[ Ссылка ]
10. Does “Starvation Mode” Exist?
[ Ссылка ]
Watch the full 25 episode season here:
[ Ссылка ]
Subscribe here:
‣ [ Ссылка ]
-------------------------------
Help SUPPORT the channel by:
1. Trying one of my training programs: → [ Ссылка ]
2. Buying my channel merch:
→ [ Ссылка ]
3. Checking out what my sponsors have to offer:
▹ MASS (Monthly Research Review)
‣ [ Ссылка ]
‣ Only $25/month (pre-paid yearly)
▹ PEScience Supplements
‣ [ Ссылка ]
‣ Use discount code JEFF to save $$
▹ RISE Training Gear and Sportwear
‣ [ Ссылка ]
‣ Use discount code JEFF to save 10%
▹ Body-Analyser Weight and Bodyfat % Scale
‣ [ Ссылка ]
‣ Use the above link to save 60% off!
-------------------------------
Follow me on social media:
INSTAGRAM ‣ [ Ссылка ]
SNAPCHAT ‣ [ Ссылка ]
FACEBOOK ‣ [ Ссылка ]
TWITTER ‣ [ Ссылка ]
PODCAST ‣ The Jeff Nippard Podcast on iTunes and Stitcher
-------------------------------
SOURCES:
1.
[ Ссылка ]
[ Ссылка ]
2.
[ Ссылка ]
[ Ссылка ]
3.
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
4.
[ Ссылка ]
5.
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
6.
[ Ссылка ]
[ Ссылка ]
7.
[ Ссылка ]
8.
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
9.
[ Ссылка ]
[ Ссылка ]
10.
[ Ссылка ]
[ Ссылка ]
MUSIC
‣ Lakey Inspired - Going Up
Filmed and edited by me and Rashaun R using Final Cut Pro X and Sony A6500
Rashaun's YouTube:
‣[ Ссылка ]
-------------------------------
About me: I'm a Canadian natural pro bodybuilder and internationally-qualified powerlifter with a BSc in biochemistry/chemistry and a passion for science. I've been training for 12 years drug-free. I'm 5'5 and fluctuate between 160 lbs (lean) and 180 lbs (bulked).
-------------------------------
Disclaimers: Jeff Nippard is not a doctor or a medical professional. Always consult a physician before starting any exercise program. Use of this information is strictly at your own risk. Jeff Nippard will not assume any liability for direct or indirect losses or damages that may result from the use of information contained in this video including but not limited to economic loss, injury, illness or death.
10 Fitness Myths Busted In 10 Minutes
Теги
vlogvloggeriifymsciencebodybuildinglegsarmschestbackfit couplebuild musclejeff nippardchristian guzmansummer shreddingleanrippedabsdietlose weightfatfitnessflexbicepsshreddedgymsharkalphaletephysiquemotivationnatural bodybuildingcanadiandoes weightlifting stunt your growthhow much protein do i need to build musclehow much protein can your body absorb per mealhow much protein should i take a dayfitness myths