⚡ Welcome to Catalyst University! I am Kevin Tokoph, PT, DPT.
I hope you enjoy the video! Please leave a like and subscribe! 🙏
INSTAGRAM | @thecatalystuniversity
Follow me on Instagram @thecatalystuniversity for additional helpful content and for my more fun side: Pets, Workouts, Dragon Ball Z
SleepPhones® | Need to Relax? Ocean waves, ASMR, Rainstorms, and Theta Waves while you sleep with SleepPhones® at this link: [ Ссылка ] - Use the Coupon Code, “CatalystRelax”, at the checkout for some awesome savings.
More details here in my new video: [ Ссылка ]
MERCHANDISE
Be sure to check out custom Catalyst University merchandise!
LINK | [ Ссылка ]
PATREON
LINK | [ Ссылка ]
Biosignaling | Receptor Desensitization by Beta-arrestin
Теги
Kevin tokophtokophcatalyst universitybiologybiochemistryanatomyphysiologyusmlemedical schoolmed schoolphysical therapyPT schoolcrash coursetutorialpsychometricssensitivityspecificityspecial testdemonstrationNPTECervical spineLumbar spineLow back painChiropractorTechniqueManipulationMuscleOriginInsertionActionInnervationBlood supplyNerveBrainTreatmentTherapeutic ExerciseTherExNeuromuscularEnzymeworkoutexerciseneck painchemistry