Hi everyone! In today's video, I'm presenting you another episode of my real vs fake series featuring the VCA 5 motif vintage alhambra pendant. Hope you enjoy it! #vca #vancleefarpels #jewelry #jewelrycollection #luxuryyoutuber
** Link to the fake one ** : [ Ссылка ]
Music by MYSM - Soft Cream - [ Ссылка ]
VCA Pendant Real VS Fake ✅ || Learn how to spot the differences
Теги
vcavancleefandarpelsvcajewelrymyjewelrycollectionluxuryjewelrycollection2022vcavscartiervcaunboxing2022vcapendantvcabraceletvcanecklacevcaearringsvcarealvsfakeluxuryjewelryvancleefandarpelsunboxingrolexdatejustcartiercartierunboxingcartierunboxing2022cartierjewelryvcaalhambravcaonyxvcamotherofpearlvcaguillochevcasweetalhambraminimalistjewelrycollectionvcareviewvancleefandarpelsreviewvcabutterflyvcacarnelianvcadiamondvcaholidayvancleefandarpelsfakevsrealvcadupe
