This is a reworked version of Season Two's opening credits/theme song, with Julie Anne Haddock (Cindy), Felice Schachter (Nancy), and Julie Piekarski (Sue Ann) included in the opening credits. The three girls, who had starred during Season One of the show, were fired before Season Two began, along with Molly Ringwald and John Lawlor, because it was felt that the series' cast was too large.
However, even after being unceremoniously canned by the producers, the three actresses graciously agreed to appear occasionally during Season Two and Three, to give the series some continuity. The three talented actresses variously appear in "Gossip" (2-09), "Sex Symbol" (2-11), "Pretty Babies" (2-14), "Front Page" (3-09), "Dear Me" (3-11), "Green Eyed Monster" (3-13), "The Way We Were, Part One" (archival footage, 5-25), "The Way We Were, Part Two" (archival footage, 5-26), and "The Little Chill" (8-08). I would have included Molly Ringwald, but she only appeared in one episode ("The New Girl, part two"). If she had appeared occasionally in seasons two and three, I definitely would have included her in this theme song/credit sequence, but one appearance didn't seem to warrant it. :) For a version of the video with Molly included, click here: [ Ссылка ]
This is how the Season Two opening credits/theme song might have looked if the girls hadn't been fired after the first season. Splice this video into your favorite Season Two or Season Three episode for full effect.
"Facts of Life" Lyrics:
You take the good, you take the bad
You take them both, and there you have
The facts of life
The facts of life
There's a time you got to go and show
You're grown and now you know about
The facts of life
The facts of life
When the world never seems
To be living up to your dreams
And suddenly you're finding out
The facts of life are all about you
You, all about you
It takes a lot to get 'em right
When you're learning the facts of life
Learning the facts of life
Learning the facts of llllllliiiiife!
Facts of Life TV Theme Song ("Lost Girls" included)
Теги
FactsoflifeSeasontwoopeningcreditsthemejuliepiekarskiannehaddockfeliceschachterfaneditlostgirlsfiredwhelchellisafieldskimmindycohncindynancyjomrs.garrettblairtootienatalieThe Facts Of Life (TV Program)SongringwaldMrs. G.julie anne haddockjulie piekarskifelice schachtermolly ringwaldtheme song1980ssitcomhollywoodactressestelevisionretroEastland schoolClassicE! true hollywood storycindy webstersue ann weavernancy olson