let's talk. for real, this time.
this track is a tribute to and based on the online series "Inanimate Insanity". hosted by a sentient phone known as MePhone4, this competition-based reality show has various inanimate objects undergo multiple challenges in order to win a prize.
this project took more than two months to work on, and was in light of II2's finale rapidly approaching. this was definitely the most ambitious project i have ever took on in a multitude of aspects, and i am relieved and happy to finally see the finished result. i hope you enjoy this as much as i did working on it :)
congratulations once again to Inanimate Insanity for reaching its finale, and a big thank you to all the crew for making this project possible in the first place. you all have made a big influence in the OSC, and i wish the best for your future endeavors. ♡
fun fact: this song was heavily influenced by three of my favorite EDM tracks...see if you can figure them out!
- - - - - - - - - - - - - - - - - - - -
# | links
Inanimate Insanity made by AnimationEpic
[ Ссылка ]
[ Ссылка ]
bandcamp link: [ Ссылка ]
soundcloud link: [ Ссылка ]
- - - - - - - - - - - - - - - - - - - -
# | credits
producing and mastering | Nate Bait
visuals | Nate Bait
| visualizer made using musicvid.org
| object assets from the Inanimate Insanity wiki
| various motifs from Inanimate Insanity and the AnimationEpic channel
| "Aces High" motif from Kevin MacLeod under CC BY 4.0
[ Ссылка ]
- - - - - - - - - - - - - - - - - - - -
# | info
Title: escapism 《 an inanimate insanity remix 》
Artist: Nate Bait
Length: 5m 59s
BPM: 170
Genre: Neurofunk / Drum and Bass
- - - - - - - - - - - - - - - - - - - -
☆ any preexisting content featured in this video is not mine. if you own any preexisting content in this video and would like me to retract this video please let me know. ☆
WMCrBeAL3NI
#inanimateinsanity #objectshow
escapism 《 an inanimate insanity remix 》
Теги
bfdibattlefordreamislandinanimateinsanityinvitationaliiiiiseasons2s3episode161718finalefinalanimationepicanimationepicobjectshowshowscommunityoscthefutureissoyesterdayafterlifeinlimelightkeeponcleaningtacotacostaco'stiradeintrorecapmephonestevecobstributesamplesamplessampledremixcovermedleymontageelectronicedmmusicvideodrumandbassdnbneurofunkglitchosustoryboardstoryboardingargalternaterealitygame