As always, the steps of an SDS-PAGE will depend on your specific lab and protocol. In this video, we will explore the general theory of separating and visualizing protein by SDS-PAGE, a technique very similar to DNA agarose gel electrophoresis. This procedure is the precursor to the Western blot.
Standard curve tutorial in next video:
Biotechniques | Principles of SDS-PAGE (Protein Separation)
Теги
Kevin tokophtokophcatalyst universitybiologybiochemistryanatomyphysiologyusmlemedical schoolmed schoolphysical therapyPT schoolcrash coursetutorialpsychometricssensitivityspecificityspecial testdemonstrationNPTECervical spineLumbar spineLow back painChiropractorTechniqueManipulationMuscleOriginInsertionActionInnervationBlood supplyNerveBrainTreatmentTherapeutic ExerciseTherExNeuromuscularEnzymeworkoutexerciseneck painchemistry